TB-500 is a synthetic peptide corresponding to the active region of thymosin beta-4 (Tβ4), a naturally occurring 43-amino-acid protein found in virtually all mammalian cells. Where the full-length protein performs several intracellular roles, TB-500 isolates the sequence responsible for its best-known function — binding actin and regulating cell movement — making it a standard tool compound in cell-migration, wound-repair, and tissue-remodeling research. This overview covers the parent protein's biology, the fragment's mechanism, the key literature, and how TB-500 is positioned among repair peptides.
The parent protein: thymosin beta-4
Tβ4 was isolated from thymic tissue in 1981 by Allan Goldstein and colleagues during research into thymic peptides. It was soon recognized as the principal intracellular actin-sequestering protein: Tβ4 binds G-actin monomers in a 1:1 complex, controlling the pool of actin available for polymerization. Because actin dynamics underlie cell shape, motility, and division, Tβ4 touches nearly every process involving cell movement — which is why fragments of it became research tools for repair biology.
How TB-500 works in research models
The actin-binding activity of Tβ4 localizes to a short motif (centered on the LKKTETQ sequence) within the full protein. TB-500 is the synthetic research peptide built around that active region. In laboratory models, its studied effects cluster around three processes:
- Cell migration: by regulating actin polymerization, the peptide influences how repair cells — fibroblasts, endothelial cells, keratinocytes — move into injured regions in models.
- Angiogenesis signaling: endothelial-cell models describe effects on vessel-sprouting behavior, relevant to re-establishing blood supply in damaged tissue.
- Repair-cell recruitment: animal research examines mobilization of progenitor and repair cells, including the cardiac research described below.
Research timeline
After Tβ4's 1981 isolation and its identification as the major actin-sequestering factor through the 1980s–90s, repair-focused research accelerated in the 2000s. Dermal and corneal wound models (including work by Gabriel Sosne's group) described accelerated closure markers. A landmark cardiac study (Smart and colleagues, Nature, 2011) reported that Tβ4 primed epicardial cells in heart-injury models, stimulating repair-cell activity. Fragment-based research, including TB-500, developed in parallel as laboratories isolated the active region for experimental use. The evidence base remains preclinical.
Key published findings
- Cardiac injury models: the Nature 2011 study and follow-up work examined Tβ4's role in epicardial activation and cardiac repair-cell mobilization in animal models — among the most-cited findings in the field.
- Dermal and corneal wound models: published preclinical work describes accelerated wound-closure and reduced-inflammatory markers under research protocols.
- Actin-dynamics research: in-vitro studies continue to characterize how the active region regulates the G-actin pool and polymerization kinetics — the mechanistic core shared with the full-length protein.
- Hair-follicle and stem-cell models: additional animal research has examined follicle cycling and progenitor-cell behavior under Tβ4-fragment exposure.
Context among related compounds
TB-500 is most often studied alongside BPC-157. The pairing is mechanistically logical: TB-500 research centers on actin regulation and cell migration, while BPC-157 research centers on growth-factor and angiogenesis signaling — two complementary dimensions of tissue-repair models. Both are components of the KLOW research blend.
What researchers examine
Research questions include actin-sequestration kinetics, endothelial migration in wound models, cardiac progenitor behavior, comparative fragment-versus-full-length pharmacology, and combination designs with growth-factor-pathway compounds. TB-500's defined mechanism makes it a clean tool for dissecting the migration component of repair.
Frequently asked research questions
Is TB-500 the same as thymosin beta-4?
No. TB-500 is a synthetic peptide based on Tβ4's active actin-binding region. The full-length 43-amino-acid protein performs additional intracellular roles; the fragment isolates the migration-relevant activity for research use.
What is TB-500's core research mechanism?
Actin binding and the regulation of cell migration — the fundamental process by which repair cells move into damaged tissue in research models.
What was the Nature 2011 finding?
A study by Smart and colleagues reported that thymosin beta-4 primed epicardial cells in cardiac injury models, stimulating repair-cell mobilization — a landmark in cardiac-repair peptide research.
Is TB-500 an approved treatment?
No. It is a research compound supplied strictly for qualified in-vitro laboratory use and is not for human or veterinary use.
How is it supplied and verified?
Lyophilized powder in sealed vials, identity and purity verified at ≥99% by independent third-party HPLC analysis.
Why do some studies use full-length Tβ4 instead of TB-500?
The full 43-amino-acid protein carries additional functional regions beyond the actin-binding motif. Studies examining non-migration functions of Tβ4 use the full protein; studies isolating migration and repair-cell movement use the active-region fragment — TB-500.
How should the research material be stored?
Lyophilized vials: frozen at -20°C or below for long-term storage, protected from light and moisture. After reconstitution under sterile laboratory conditions, keep refrigerated at 2–8°C and use within the protocol's validated window.
How the evidence base reads
The TB-500/Tβ4 literature is entirely preclinical: cell-culture mechanism work plus rodent wound, cardiac, and corneal models, anchored by high-profile publications such as the 2011 Nature cardiac study on the full-length protein. Fragment-specific (TB-500) studies are a subset of that base. No completed human trials exist; the compound is a laboratory research tool.
Laboratory handling and stability
For long-term research storage, keep lyophilized vials frozen at -20°C or below, protected from light and moisture; short-term handling at 2–8°C is standard. Reconstitution should be performed only under sterile laboratory conditions with the laboratory-grade solvent specified by the research protocol, and reconstituted material should be kept cold, protected from light, and used within the validated window of the protocol. Record vial lot numbers and retain the certificate of analysis with study records — traceability is a baseline requirement for reproducible work.
Related research in this library
BPC-157 · GHK-Cu · KLOW Blend
Why the actin pathway matters in repair research
Actin is the most abundant protein in most cells, and its constant assembly and disassembly is what physically moves cells. In wound models, the rate-limiting step is often not cell proliferation but cell migration — repair cells physically reaching the damage. That is the bottleneck the Tβ4 active region addresses, and it explains the breadth of TB-500 research: any model where repair depends on cells getting to the injury is a candidate. Cardiac, dermal, corneal, and neural models all share that dependency.
Is TB-500 on any restricted lists?
Like most research peptides in this class, TB-500/Tβ4 is prohibited in sport under WADA's unapproved-substances category. It has no approved human use anywhere and is supplied strictly as laboratory research material.
Form, handling, and verification
TB-500 is supplied as a lyophilized (freeze-dried) powder in sealed vials, with identity and purity verified at ≥99% by independent third-party HPLC analysis. Lyophilized material should be stored in a cool, dry environment away from light and handled per standard laboratory protocol with appropriate protective equipment.
View TB-500 research material →
Research Use Only. All materials referenced are supplied strictly for qualified in-vitro laboratory research. Not for human or veterinary use, and not intended to diagnose, treat, cure, or prevent any disease. Nothing in this article constitutes medical advice, dosing guidance, or a recommendation for human use.
Technical Specifications
Structural identifiers verified against the NIH PubChem database.
| Property | Value |
|---|---|
| Common designation | TB-500 |
| Alternate names | Timbetasin, Thymosin beta-4 fragment, Tβ4 |
| Amino acid sequence | Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) |
| Chain length | 43 residues, N-terminally acetylated |
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963 g/mol |
| CAS number | 77591-33-4 |
| PubChem CID | 16132341 |
| Physical form | Lyophilized white powder, sealed vial |
| Purity specification | ≥99% by third-party HPLC |
| Analytical methods | RP-HPLC, mass spectrometry |
| Documentation | Certificate of Analysis issued per lot |
Source: National Center for Biotechnology Information, PubChem Compound Summary — CID 16132341. Supplied for qualified in-vitro laboratory research only; not for human consumption.